Iga Lambai Monoclonal

Monoclonal antibody for SUR1 and SUR2B

SMC-432D 0.1mg
EUR 423.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Iga Monoclonal Laboratories manufactures the iga lambai monoclonal reagents distributed by Genprice. The Iga Lambai Monoclonal reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact iga monoclonal. Other Iga products are available in stock. Specificity: Iga Category: Lambai Group: Monoclonal

True Blue

1mg Ask for price
Description: True Blue

True Blue

50mg Ask for price
Description: True Blue

True Blue

5mg Ask for price
Description: True Blue

JBS True Blue

300µl
EUR 11.84

JBS True Blue

300 µl
EUR 16
Description: JBS True Blue

True Blue Chloride

100mg
EUR 11200
Description: 71431-30-6

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 423.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 480
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 390.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 488.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 565.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 594.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 633.

Monoclonal information

Mouse anti IgA Monoclonal Antibody

MBS460226-5x01mg 5x0.1mg
EUR 1185

Human IgA Monoclonal Antibody [15D6]

MBS375476-002mg 0.02mg
EUR 335

Human IgA Monoclonal Antibody [15D6]

MBS375476-005mg 0.05mg
EUR 435

Human IgA Monoclonal Antibody [15D6]

MBS375476-01mg 0.1mg
EUR 520

Human IgA Monoclonal Antibody [15D6]

MBS375476-5x01mg 5x0.1mg
EUR 2125

Mouse anti IgA Monoclonal Antibody

TA354337 100 µg Ask for price

Human IgA (Total IgA) mouse monoclonal antibody, clone A909

1A1-A909 1 mg Ask for price

IgA (14V16) Rabbit Monoclonal Antibody

E28M5108 100ul
EUR 295

Monoclonal Anti-human IgA antibody.

TMI012-0.25MG 0.25mg
EUR 169
Description: Specific to human IgA, no cross reaction with IgE, IgG, and IgM. This antibody can be paired with TMI013.

Monoclonal Anti-human IgA antibody.

TMI012-1MG 1mg
EUR 569
Description: Specific to human IgA, no cross reaction with IgE, IgG, and IgM. This antibody can be paired with TMI013.

Monoclonal Anti-human IgA antibody.

TMI013-0.25MG 0.25mg
EUR 169
Description: Specific to human IgA, no cross reaction with IgE, IgG, and IgM. This antibody can be paired with TMI012.

Monoclonal Anti-human IgA antibody.

TMI013-1MG 1mg
EUR 569
Description: Specific to human IgA, no cross reaction with IgE, IgG, and IgM. This antibody can be paired with TMI012.

CD79a Recombinant monoclonal antibody (IGA/1790R)

MBS566843-01mg 0.1mg
EUR 615

CD79a Recombinant monoclonal antibody (IGA/1790R)

MBS566843-5x01mg 5x0.1mg
EUR 2720

HRP*Monoclonal Mouse Anti- Human IgA

CE30249-10mL 10 mL
EUR 2000

HRP*Monoclonal Mouse Anti- Human IgA

CE30249-1mL 1 mL
EUR 300

HRP*Monoclonal Mouse Anti- Human IgA

C030249-10ml 10ml
EUR 2148

HRP*Monoclonal Mouse Anti- Human IgA

C030249-1ml 1ml
EUR 424.8

FITC*Monoclonal Mouse Anti- Human IgA

CE30649-10mL 10 mL
EUR 2000

FITC*Monoclonal Mouse Anti- Human IgA

CE30649-1mL 1 mL
EUR 250

FITC*Monoclonal Mouse Anti- Human IgA

C030649-10ml 10ml
EUR 2148

FITC*Monoclonal Mouse Anti- Human IgA

C030649-1ml 1ml
EUR 373.2

BIOTIN*Monoclonal Mouse Anti- Human IgA

CE30849-10mL 10 mL
EUR 2000

BIOTIN*Monoclonal Mouse Anti- Human IgA

CE30849-1mL 1 mL
EUR 300

Mouse Anti Dog Iga Monoclonal Antibody

DMABT-51916MD 2 ml
EUR 546
Description: Mouse

Mouse Anti Pig Iga Monoclonal Antibody

DMABT-51917MP 0.25 mg
EUR 567
Description: Mouse

Mouse Anti Cat Iga Monoclonal Antibody

DMABT-51971MC 0.25 mg
EUR 567
Description: Mouse

Mouse Anti Cat Iga Monoclonal Antibody

DMABT-51973MC 2 ml
EUR 546
Description: Mouse