Teva And Monoclonal Anitbody For Sars

Monoclonal antibody for SUR1 and SUR2B

SMC-432D 0.1mg
EUR 423.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Human IgG antibody Laboratories manufactures the teva and monoclonal anitbody for sars reagents distributed by Genprice. The Teva And Monoclonal Anitbody For Sars reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact SARS Antibody. Other Teva products are available in stock. Specificity: Teva Category: And Group: Monoclonal Anitbody

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 477.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 564
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC/Cy7.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 474
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Biotin.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 495.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 350.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 482.4
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 405.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 470.4
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 488.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 472.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 594.

Monoclonal Anitbody information

Mouse Anit SARS-CoV-2 Nucleocapsid Monoclonal Clone 6H3

MBS8420295-5x01mL 5x0.1mL
EUR 3500

SARS Coronavirus Monoclonal Antibody

MBS5316481-1mg 1mg
EUR 1370

SARS Coronavirus Monoclonal Antibody

MBS5316481-5x1mg 5x1mg
EUR 6015

SARS Coronavirus Monoclonal Antibody

MBS5316482-1mg 1mg
EUR 1370

SARS Coronavirus Monoclonal Antibody

MBS5316482-5x1mg 5x1mg
EUR 6015

SARS Coronavirus Monoclonal Antibody

MBS5316483-1mg 1mg
EUR 1370

SARS Coronavirus Monoclonal Antibody

MBS5316483-5x1mg 5x1mg
EUR 6015

SARS Coronavirus Monoclonal Antibody

MBS5316484-1mg 1mg
EUR 1370

SARS Coronavirus Monoclonal Antibody

MBS5316484-5x1mg 5x1mg
EUR 6015

SARS-COV/SARS-COV-2 NP Monoclonal Antibody(2019-nCoV)

MBS2563841-1mg 1mg
EUR 1050

SARS-COV/SARS-COV-2 NP Monoclonal Antibody(2019-nCoV)

MBS2563841-5x1mg 5x1mg
EUR 4690

SARS-COV/SARS-COV-2 NP Monoclonal Antibody(2019-nCoV)

MBS2563843-005mL 0.05mL
EUR 275

SARS-COV/SARS-COV-2 NP Monoclonal Antibody(2019-nCoV)

MBS2563843-01mL 0.1mL
EUR 415

SARS-COV/SARS-COV-2 NP Monoclonal Antibody(2019-nCoV)

MBS2563843-5x01mL 5x0.1mL
EUR 1815

SARS-COV/SARS-COV-2 NP Monoclonal Antibody(2019-nCoV)

MBS2563844-005mL 0.05mL
EUR 275

SARS-COV/SARS-COV-2 NP Monoclonal Antibody(2019-nCoV)

MBS2563844-01mL 0.1mL
EUR 415

SARS-COV/SARS-COV-2 NP Monoclonal Antibody(2019-nCoV)

MBS2563844-5x01mL 5x0.1mL
EUR 1815