Monoclonal antibody for SUR1 and SUR2B |
|
SMC-432D |
Stressmarq |
0.1mg |
EUR 423.6 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated. |
Human IgG antibody Laboratories manufactures the teva and monoclonal anitbody for sars reagents distributed by Genprice. The Teva And Monoclonal Anitbody For Sars reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact SARS Antibody. Other Teva products are available in stock. Specificity: Teva Category: And Group: Monoclonal Anitbody
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 478.8 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 633. |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 478.8 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 655. |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 478.8 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 680. |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 478.8 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 700. |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 471.6 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Alkaline Phosphatase. |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 477.6 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC. |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 564 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC/Cy7. |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 474 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Biotin. |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 495.6 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 350. |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 482.4 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 405. |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 470.4 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 488. |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 472.8 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 594. |
Monoclonal Anitbody information
Human Anti-Myelin Oligodendrocyte Glycoprotein Anitbody(Anti-MOG)ELISA Kit |
|
YLA1282HU-96T |
Shanghai YL Biotech |
96T |
Ask for price |
Human Anti-Myelin Oligodendrocyte Glycoprotein Anitbody (Anti-MOG) ELISA Kit |
|
MBS167023-10x96StripWells |
MyBiosource |
10x96-Strip-Wells |
EUR 3460 |
Human Anti-Myelin Oligodendrocyte Glycoprotein Anitbody (Anti-MOG) ELISA Kit |
|
MBS167023-48StripWells |
MyBiosource |
48-Strip-Wells |
EUR 285 |
Human Anti-Myelin Oligodendrocyte Glycoprotein Anitbody (Anti-MOG) ELISA Kit |
|
MBS167023-5x96StripWells |
MyBiosource |
5x96-Strip-Wells |
EUR 1750 |
Human Anti-Myelin Oligodendrocyte Glycoprotein Anitbody (Anti-MOG) ELISA Kit |
|
MBS167023-96StripWells |
MyBiosource |
96-Strip-Wells |
EUR 425 |
Human Anti-Myelin Oligodendrocyte Glycoprotein Anitbody, Anti-MOG GENLISA ELISA |
|
KBH3678 |
Krishgen |
1 x 96 wells |
EUR 286 |
Mouse Anit SARS-CoV-2 Nucleocapsid Monoclonal Clone 6H3 |
|
MBS8420295-01mL |
MyBiosource |
0.1mL |
EUR 820 |
Mouse Anit SARS-CoV-2 Nucleocapsid Monoclonal Clone 6H3 |
|
MBS8420295-5x01mL |
MyBiosource |
5x0.1mL |
EUR 3500 |
SARS-M Monoclonal Antibody |
|
UB-GEN-4373 |
UpingBio |
100 ul |
EUR 200 |
SARS-E2 Monoclonal Antibody |
|
UB-GEN-4372 |
UpingBio |
100 ul |
EUR 200 |
SARS Coronavirus Monoclonal Antibody |
|
MBS5316481-1mg |
MyBiosource |
1mg |
EUR 1370 |
SARS Coronavirus Monoclonal Antibody |
|
MBS5316481-5x1mg |
MyBiosource |
5x1mg |
EUR 6015 |
SARS Coronavirus Monoclonal Antibody |
|
MBS5316482-1mg |
MyBiosource |
1mg |
EUR 1370 |
SARS Coronavirus Monoclonal Antibody |
|
MBS5316482-5x1mg |
MyBiosource |
5x1mg |
EUR 6015 |
SARS Coronavirus Monoclonal Antibody |
|
MBS5316483-1mg |
MyBiosource |
1mg |
EUR 1370 |
SARS Coronavirus Monoclonal Antibody |
|
MBS5316483-5x1mg |
MyBiosource |
5x1mg |
EUR 6015 |
SARS Coronavirus Monoclonal Antibody |
|
MBS5316484-1mg |
MyBiosource |
1mg |
EUR 1370 |
SARS Coronavirus Monoclonal Antibody |
|
MBS5316484-5x1mg |
MyBiosource |
5x1mg |
EUR 6015 |
SARS-COV/SARS-COV-2 NP Monoclonal Antibody(2019-nCoV) |
|
MBS2563841-1mg |
MyBiosource |
1mg |
EUR 1050 |
SARS-COV/SARS-COV-2 NP Monoclonal Antibody(2019-nCoV) |
|
MBS2563841-5x1mg |
MyBiosource |
5x1mg |
EUR 4690 |
SARS-COV/SARS-COV-2 NP Monoclonal Antibody(2019-nCoV) |
|
MBS2563843-005mL |
MyBiosource |
0.05mL |
EUR 275 |
SARS-COV/SARS-COV-2 NP Monoclonal Antibody(2019-nCoV) |
|
MBS2563843-01mL |
MyBiosource |
0.1mL |
EUR 415 |
SARS-COV/SARS-COV-2 NP Monoclonal Antibody(2019-nCoV) |
|
MBS2563843-5x01mL |
MyBiosource |
5x0.1mL |
EUR 1815 |
SARS-COV/SARS-COV-2 NP Monoclonal Antibody(2019-nCoV) |
|
MBS2563844-005mL |
MyBiosource |
0.05mL |
EUR 275 |
