Lab Reagents
Human IgG antibody Laboratories manufactures the teva and monoclonal anitbody for sars reagents distributed by Genprice. The Teva And Monoclonal Anitbody For Sars reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact SARS Antibody. Other Teva products are available in stock. Specificity: Teva Category: And Group: Monoclonal Anitbody
Monoclonal Anitbody information
Monoclonal antibody for SUR1 and SUR2B |
SMC-432D-DY633 |
Stressmarq |
0.1mg |
EUR 466.8 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 633. |
Monoclonal antibody for SUR1 and SUR2B |
SMC-432D-FITC |
Stressmarq |
0.1mg |
EUR 469.2 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with FITC. |
Monoclonal antibody for SUR1 and SUR2B |
SMC-432D-HRP |
Stressmarq |
0.1mg |
EUR 464.4 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with HRP. |
Monoclonal antibody for SUR1 and SUR2B |
SMC-432D-P594 |
Stressmarq |
0.1mg |
EUR 487.2 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with PE/ATTO 594. |
Monoclonal antibody for SUR1 and SUR2B |
SMC-432D-PCP |
Stressmarq |
0.1mg |
EUR 477.6 |
|
Description: A monoclonal antibody from clone S323A-31 against Human SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with PerCP. |
Monoclonal antibody for SUR1 and SUR2B |
SMC-432D-RPE |
Stressmarq |
0.1mg |
EUR 475.2 |
|
Description: A monoclonal antibody from clone S323A-31 against Human SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with RPE. |
Monoclonal antibody for SUR1 and SUR2B |
SMC-432D-STR |
Stressmarq |
0.1mg |
EUR 476.4 |
|
Description: A monoclonal antibody from clone S323A-31 against Human SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Streptavidin. |
Monoclonal antibody for SUR1 and SUR2B |
SMC-432S |
Stressmarq |
0.012mg |
EUR 78 |
|
Description: A monoclonal antibody from clone S323A-31 against Human SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated. |
SARS-CoV-2 Spike Monoclonal Antibody |
A73664-050 |
EpiGentek |
50 ul |
EUR 341 |
SARS-CoV-2 Spike Monoclonal Antibody |
A73664-100 |
EpiGentek |
100 ul |
EUR 518.1 |
SARS-CoV-2 Spike Monoclonal Antibody |
A73664 |
EpiGentek |
|
|
Mouse Monoclonal Anti-SARS Spike Protein IgG |
AB-15710 |
Alpha Diagnostics |
20 ug |
EUR 489.6 |
Mouse Monoclonal Anti-SARS Nucleocapsid protein IgG |
AB-17810 |
Alpha Diagnostics |
50 ug |
EUR 562.8 |
Mouse Monoclonal Anti-SARS Nucleocapsid Protein IgG |
AB-18010 |
Alpha Diagnostics |
50 ug |
EUR 562.8 |
SARS-CoV-2 N Protein Monoclonal Antibody |
A73663-050 |
EpiGentek |
50 ul |
EUR 341 |
SARS-CoV-2 N Protein Monoclonal Antibody |
A73663-100 |
EpiGentek |
100 ul |
EUR 518.1 |